Icon representing a puzzle

2393: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 9,803
  2. Avatar for Cancer Blasters! 12. Cancer Blasters! 1 pt. 9,784
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 9,400
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,036
  1. Avatar for silent gene 21. silent gene Lv 1 20 pts. 10,321
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 18 pts. 10,310
  3. Avatar for akaaka 23. akaaka Lv 1 16 pts. 10,298
  4. Avatar for Joanna_H 24. Joanna_H Lv 1 15 pts. 10,291
  5. Avatar for Steven Pletsch 25. Steven Pletsch Lv 1 13 pts. 10,235
  6. Avatar for AlkiP0Ps 26. AlkiP0Ps Lv 1 12 pts. 10,219
  7. Avatar for g_b 27. g_b Lv 1 11 pts. 10,214
  8. Avatar for equilibria 28. equilibria Lv 1 10 pts. 10,190
  9. Avatar for ecali 29. ecali Lv 1 9 pts. 10,085
  10. Avatar for RichGuilmain 30. RichGuilmain Lv 1 8 pts. 10,059

Comments