Icon representing a puzzle

2393: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 9,803
  2. Avatar for Cancer Blasters! 12. Cancer Blasters! 1 pt. 9,784
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 9,400
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,036
  1. Avatar for SaraL 51. SaraL Lv 1 1 pt. 9,546
  2. Avatar for jtwolff 52. jtwolff Lv 1 1 pt. 9,528
  3. Avatar for Merf 53. Merf Lv 1 1 pt. 9,502
  4. Avatar for Simek 54. Simek Lv 1 1 pt. 9,400
  5. Avatar for pfirth 55. pfirth Lv 1 1 pt. 9,302
  6. Avatar for kitsoune 56. kitsoune Lv 1 1 pt. 9,235
  7. Avatar for Arne Heessels 57. Arne Heessels Lv 1 1 pt. 9,124
  8. Avatar for abiogenesis 58. abiogenesis Lv 1 1 pt. 9,046
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 9,011
  10. Avatar for Dr.Sillem 60. Dr.Sillem Lv 1 1 pt. 8,979

Comments