Icon representing a puzzle

2393: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 9,803
  2. Avatar for Cancer Blasters! 12. Cancer Blasters! 1 pt. 9,784
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 9,400
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,036
  1. Avatar for zbp 61. zbp Lv 1 1 pt. 8,835
  2. Avatar for jdmclure 62. jdmclure Lv 1 1 pt. 8,661
  3. Avatar for Hexafluorouranate 63. Hexafluorouranate Lv 1 1 pt. 8,606
  4. Avatar for Oransche 64. Oransche Lv 1 1 pt. 8,351
  5. Avatar for Mohoernchen 65. Mohoernchen Lv 1 1 pt. 8,100
  6. Avatar for Savas 66. Savas Lv 1 1 pt. 8,036
  7. Avatar for pruneau_44 67. pruneau_44 Lv 1 1 pt. 7,879
  8. Avatar for Altercomp 68. Altercomp Lv 1 1 pt. 7,813
  9. Avatar for Mdmfam 69. Mdmfam Lv 1 1 pt. 7,791
  10. Avatar for furi0us 70. furi0us Lv 1 1 pt. 7,255

Comments