Icon representing a puzzle

2393: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,012
  2. Avatar for Go Science 2. Go Science 68 pts. 10,960
  3. Avatar for Contenders 3. Contenders 44 pts. 10,558
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,442
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,401
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,400
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 10,291
  8. Avatar for Australia 8. Australia 3 pts. 10,219
  9. Avatar for Firesign 9. Firesign 1 pt. 10,002
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,845

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,009
  2. Avatar for Galaxie 2. Galaxie Lv 1 56 pts. 11,008
  3. Avatar for phi16 3. phi16 Lv 1 29 pts. 10,979
  4. Avatar for alcor29 4. alcor29 Lv 1 14 pts. 10,969
  5. Avatar for hansvandenhof 5. hansvandenhof Lv 1 6 pts. 10,968
  6. Avatar for Sandrix72 6. Sandrix72 Lv 1 2 pts. 10,960
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 1 pt. 10,958
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 1 pt. 10,957
  9. Avatar for Bletchley Park 9. Bletchley Park Lv 1 1 pt. 10,533
  10. Avatar for silent gene 10. silent gene Lv 1 1 pt. 10,428

Comments