Icon representing a puzzle

2393: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,012
  2. Avatar for Go Science 2. Go Science 68 pts. 10,960
  3. Avatar for Contenders 3. Contenders 44 pts. 10,558
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,442
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,401
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,400
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 10,291
  8. Avatar for Australia 8. Australia 3 pts. 10,219
  9. Avatar for Firesign 9. Firesign 1 pt. 10,002
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,845

  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 47 pts. 10,550
  2. Avatar for Galaxie 12. Galaxie Lv 1 44 pts. 10,487
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 40 pts. 10,442
  4. Avatar for Punzi Baker 3 14. Punzi Baker 3 Lv 1 37 pts. 10,438
  5. Avatar for gmn 15. gmn Lv 1 34 pts. 10,418
  6. Avatar for MicElephant 16. MicElephant Lv 1 31 pts. 10,412
  7. Avatar for fpc 17. fpc Lv 1 28 pts. 10,401
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 26 pts. 10,400
  9. Avatar for roarshock 19. roarshock Lv 1 24 pts. 10,393
  10. Avatar for Opelgang 20. Opelgang Lv 1 22 pts. 10,340

Comments