Icon representing a puzzle

2393: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,012
  2. Avatar for Go Science 2. Go Science 68 pts. 10,960
  3. Avatar for Contenders 3. Contenders 44 pts. 10,558
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,442
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,401
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,400
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 10,291
  8. Avatar for Australia 8. Australia 3 pts. 10,219
  9. Avatar for Firesign 9. Firesign 1 pt. 10,002
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,845

  1. Avatar for manu8170 31. manu8170 Lv 1 7 pts. 10,053
  2. Avatar for phi16 32. phi16 Lv 1 6 pts. 10,016
  3. Avatar for Catherwood 33. Catherwood Lv 1 6 pts. 10,002
  4. Avatar for heather-1 34. heather-1 Lv 1 5 pts. 9,973
  5. Avatar for rosie4loop 35. rosie4loop Lv 1 4 pts. 9,907
  6. Avatar for hansvandenhof 36. hansvandenhof Lv 1 4 pts. 9,899
  7. Avatar for RegnadKcin 37. RegnadKcin Lv 1 3 pts. 9,884
  8. Avatar for guineapig 38. guineapig Lv 1 3 pts. 9,884
  9. Avatar for ShadowTactics 39. ShadowTactics Lv 1 3 pts. 9,845
  10. Avatar for Znaika 40. Znaika Lv 1 2 pts. 9,840

Comments