Icon representing a puzzle

2393: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,012
  2. Avatar for Go Science 2. Go Science 68 pts. 10,960
  3. Avatar for Contenders 3. Contenders 44 pts. 10,558
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,442
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,401
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,400
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 10,291
  8. Avatar for Australia 8. Australia 3 pts. 10,219
  9. Avatar for Firesign 9. Firesign 1 pt. 10,002
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,845
  1. Avatar for maithra 41. maithra Lv 1 2 pts. 9,828
  2. Avatar for Hillbillie 42. Hillbillie Lv 1 2 pts. 9,803
  3. Avatar for Larini 43. Larini Lv 1 2 pts. 9,785
  4. Avatar for Guido 44. Guido Lv 1 1 pt. 9,784
  5. Avatar for alcor29 45. alcor29 Lv 1 1 pt. 9,758
  6. Avatar for carsonfb 46. carsonfb Lv 1 1 pt. 9,737
  7. Avatar for vybi 47. vybi Lv 1 1 pt. 9,717
  8. Avatar for Betty Jo Bialosky 48. Betty Jo Bialosky Lv 1 1 pt. 9,705
  9. Avatar for ProfVince 49. ProfVince Lv 1 1 pt. 9,679
  10. Avatar for Trajan464 50. Trajan464 Lv 1 1 pt. 9,571

Comments