Icon representing a puzzle

2396: Revisiting Puzzle 134: Rice

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 9,357
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,291
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 8,569
  4. Avatar for METU-BIN 14. METU-BIN 1 pt. 7,712
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,801
  6. Avatar for Die Bigbrains 16. Die Bigbrains 1 pt. 2,801
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,750
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 94 pts. 10,702
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 87 pts. 10,656
  4. Avatar for MicElephant 4. MicElephant Lv 1 81 pts. 10,580
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 75 pts. 10,564
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 70 pts. 10,555
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 65 pts. 10,544
  8. Avatar for grogar7 8. grogar7 Lv 1 60 pts. 10,513
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 56 pts. 10,507
  10. Avatar for Galaxie 10. Galaxie Lv 1 51 pts. 10,488

Comments