Icon representing a puzzle

2396: Revisiting Puzzle 134: Rice

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,759
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,750
  3. Avatar for Contenders 3. Contenders 49 pts. 10,580
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,507
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 10,382
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 10,334
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,244
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,218
  9. Avatar for Australia 9. Australia 3 pts. 10,067
  10. Avatar for Cancer Blasters! 10. Cancer Blasters! 2 pts. 9,449

  1. Avatar for blazegeek 11. blazegeek Lv 1 47 pts. 10,485
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 44 pts. 10,484
  3. Avatar for g_b 13. g_b Lv 1 40 pts. 10,423
  4. Avatar for BootsMcGraw 14. BootsMcGraw Lv 1 37 pts. 10,394
  5. Avatar for WBarme1234 15. WBarme1234 Lv 1 34 pts. 10,382
  6. Avatar for gmn 16. gmn Lv 1 31 pts. 10,367
  7. Avatar for BackBuffer 17. BackBuffer Lv 1 28 pts. 10,349
  8. Avatar for Simek 18. Simek Lv 1 26 pts. 10,334
  9. Avatar for Punzi Baker 3 19. Punzi Baker 3 Lv 1 24 pts. 10,266
  10. Avatar for akaaka 20. akaaka Lv 1 22 pts. 10,266

Comments