Icon representing a puzzle

2396: Revisiting Puzzle 134: Rice

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,759
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,750
  3. Avatar for Contenders 3. Contenders 49 pts. 10,580
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,507
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 10,382
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 10,334
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,244
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,218
  9. Avatar for Australia 9. Australia 3 pts. 10,067
  10. Avatar for Cancer Blasters! 10. Cancer Blasters! 2 pts. 9,449

  1. Avatar for fpc 21. fpc Lv 1 20 pts. 10,244
  2. Avatar for Joanna_H 22. Joanna_H Lv 1 18 pts. 10,218
  3. Avatar for silent gene 23. silent gene Lv 1 16 pts. 10,216
  4. Avatar for georg137 24. georg137 Lv 1 15 pts. 10,082
  5. Avatar for AlkiP0Ps 25. AlkiP0Ps Lv 1 13 pts. 10,067
  6. Avatar for guineapig 26. guineapig Lv 1 12 pts. 10,014
  7. Avatar for heather-1 27. heather-1 Lv 1 11 pts. 10,002
  8. Avatar for hansvandenhof 28. hansvandenhof Lv 1 10 pts. 9,884
  9. Avatar for rosie4loop 29. rosie4loop Lv 1 9 pts. 9,712
  10. Avatar for NPrincipi 30. NPrincipi Lv 1 8 pts. 9,701

Comments