Icon representing a puzzle

2396: Revisiting Puzzle 134: Rice

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,759
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,750
  3. Avatar for Contenders 3. Contenders 49 pts. 10,580
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,507
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 10,382
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 10,334
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,244
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,218
  9. Avatar for Australia 9. Australia 3 pts. 10,067
  10. Avatar for Cancer Blasters! 10. Cancer Blasters! 2 pts. 9,449

  1. Avatar for carsonfb 31. carsonfb Lv 1 7 pts. 9,582
  2. Avatar for phi16 32. phi16 Lv 1 6 pts. 9,508
  3. Avatar for alcor29 33. alcor29 Lv 1 6 pts. 9,483
  4. Avatar for Guido 34. Guido Lv 1 5 pts. 9,449
  5. Avatar for Steven Pletsch 35. Steven Pletsch Lv 1 4 pts. 9,396
  6. Avatar for argyrw 36. argyrw Lv 1 4 pts. 9,360
  7. Avatar for Deleted player 37. Deleted player 3 pts. 9,357
  8. Avatar for ShadowTactics 38. ShadowTactics Lv 1 3 pts. 9,291
  9. Avatar for Larini 39. Larini Lv 1 3 pts. 9,279
  10. Avatar for Arthuriel 40. Arthuriel Lv 1 2 pts. 9,113

Comments