Icon representing a puzzle

2396: Revisiting Puzzle 134: Rice

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
November 01, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,759
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,750
  3. Avatar for Contenders 3. Contenders 49 pts. 10,580
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,507
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 10,382
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 10,334
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,244
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,218
  9. Avatar for Australia 9. Australia 3 pts. 10,067
  10. Avatar for Cancer Blasters! 10. Cancer Blasters! 2 pts. 9,449
  1. Avatar for Merf 41. Merf Lv 1 2 pts. 9,110
  2. Avatar for Helisaf 42. Helisaf Lv 1 2 pts. 9,079
  3. Avatar for Znaika 43. Znaika Lv 1 2 pts. 9,058
  4. Avatar for kitsoune 44. kitsoune Lv 1 1 pt. 8,987
  5. Avatar for ecali 45. ecali Lv 1 1 pt. 8,811
  6. Avatar for Tian00 46. Tian00 Lv 1 1 pt. 8,712
  7. Avatar for DScott 47. DScott Lv 1 1 pt. 8,641
  8. Avatar for pfirth 48. pfirth Lv 1 1 pt. 8,633
  9. Avatar for AlphaFold2 49. AlphaFold2 Lv 1 1 pt. 8,569
  10. Avatar for Dr.Sillem 50. Dr.Sillem Lv 1 1 pt. 8,532

Comments