Placeholder image of a protein
Icon representing a puzzle

2377: Electron Density Reconstruction 65

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
November 06, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments may be visible in the density.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSAAELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups


  1. Avatar for Belgium 11. Belgium 1 pt. 47,059
  2. Avatar for Team China 12. Team China 1 pt. 45,670
  3. Avatar for 202302 13. 202302 1 pt. 45,665

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 48,040
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 94 pts. 48,028
  3. Avatar for BackBuffer 3. BackBuffer Lv 1 88 pts. 48,009
  4. Avatar for LociOiling 4. LociOiling Lv 1 82 pts. 47,992
  5. Avatar for MicElephant 5. MicElephant Lv 1 77 pts. 47,955
  6. Avatar for guineapig 6. guineapig Lv 1 72 pts. 47,941
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 67 pts. 47,937
  8. Avatar for Bletchley Park 8. Bletchley Park Lv 1 63 pts. 47,926
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 58 pts. 47,918
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 54 pts. 47,912

Comments