Placeholder image of a protein
Icon representing a puzzle

2377: Electron Density Reconstruction 65

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
November 06, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments may be visible in the density.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSAAELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 48,040
  2. Avatar for Go Science 2. Go Science 65 pts. 48,028
  3. Avatar for Contenders 3. Contenders 41 pts. 47,955
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 47,937
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 47,771
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 47,706
  7. Avatar for Australia 7. Australia 4 pts. 47,667
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 47,370
  9. Avatar for Ukraine 9. Ukraine 1 pt. 47,324
  10. Avatar for VeFold 10. VeFold 1 pt. 47,272

  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 23 pts. 47,706
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 21 pts. 47,667
  3. Avatar for Steven Pletsch 23. Steven Pletsch Lv 1 19 pts. 47,622
  4. Avatar for BootsMcGraw 24. BootsMcGraw Lv 1 17 pts. 47,578
  5. Avatar for spvincent 25. spvincent Lv 1 16 pts. 47,568
  6. Avatar for Artoria2e5 26. Artoria2e5 Lv 1 15 pts. 47,391
  7. Avatar for Joanna_H 27. Joanna_H Lv 1 13 pts. 47,370
  8. Avatar for vybi 28. vybi Lv 1 12 pts. 47,367
  9. Avatar for Unc 29. Unc Lv 1 11 pts. 47,342
  10. Avatar for Commaster 30. Commaster Lv 1 10 pts. 47,324

Comments