Placeholder image of a protein
Icon representing a puzzle

2377: Electron Density Reconstruction 65

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary

Created
November 06, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments may be visible in the density.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSAAELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 48,040
  2. Avatar for Go Science 2. Go Science 65 pts. 48,028
  3. Avatar for Contenders 3. Contenders 41 pts. 47,955
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 47,937
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 47,771
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 47,706
  7. Avatar for Australia 7. Australia 4 pts. 47,667
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 47,370
  9. Avatar for Ukraine 9. Ukraine 1 pt. 47,324
  10. Avatar for VeFold 10. VeFold 1 pt. 47,272
  1. Avatar for ProfVince 41. ProfVince Lv 1 3 pts. 46,915
  2. Avatar for drumpeter18yrs9yrs 42. drumpeter18yrs9yrs Lv 1 3 pts. 46,673
  3. Avatar for Hellcat6 43. Hellcat6 Lv 1 3 pts. 46,553
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 2 pts. 46,475
  5. Avatar for georg137 45. georg137 Lv 1 2 pts. 46,369
  6. Avatar for Oransche 46. Oransche Lv 1 2 pts. 46,367
  7. Avatar for maithra 47. maithra Lv 1 2 pts. 46,366
  8. Avatar for pfirth 48. pfirth Lv 1 2 pts. 46,092
  9. Avatar for Merf 49. Merf Lv 1 1 pt. 46,039
  10. Avatar for silent gene 50. silent gene Lv 1 1 pt. 46,017

Comments