Placeholder image of a protein
Icon representing a puzzle

2377: Electron Density Reconstruction 65

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
November 06, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments may be visible in the density.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSAAELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 48,040
  2. Avatar for Go Science 2. Go Science 65 pts. 48,028
  3. Avatar for Contenders 3. Contenders 41 pts. 47,955
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 47,937
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 47,771
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 47,706
  7. Avatar for Australia 7. Australia 4 pts. 47,667
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 47,370
  9. Avatar for Ukraine 9. Ukraine 1 pt. 47,324
  10. Avatar for VeFold 10. VeFold 1 pt. 47,272

  1. Avatar for Menace0528 71. Menace0528 Lv 1 1 pt. 45,153
  2. Avatar for sp998 72. sp998 Lv 1 1 pt. 42,896
  3. Avatar for jpmehta 73. jpmehta Lv 1 1 pt. 39,670
  4. Avatar for mmosconi 74. mmosconi Lv 1 1 pt. 39,641
  5. Avatar for DipsyDoodle2016 75. DipsyDoodle2016 Lv 1 1 pt. 34,494
  6. Avatar for DOUBICN 76. DOUBICN Lv 1 1 pt. 26,909
  7. Avatar for Just_A_Nerd 77. Just_A_Nerd Lv 1 1 pt. 26,824
  8. Avatar for jeff101 78. jeff101 Lv 1 1 pt. 26,809
  9. Avatar for mm_Pin3 79. mm_Pin3 Lv 1 1 pt. 26,809

Comments