Placeholder image of a protein
Icon representing a puzzle

2377: Electron Density Reconstruction 65

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 06, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle of the same sequence, but not all the segments may be visible in the density.

Sequence
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSAAELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 48,040
  2. Avatar for Go Science 2. Go Science 65 pts. 48,028
  3. Avatar for Contenders 3. Contenders 41 pts. 47,955
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 47,937
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 47,771
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 47,706
  7. Avatar for Australia 7. Australia 4 pts. 47,667
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 47,370
  9. Avatar for Ukraine 9. Ukraine 1 pt. 47,324
  10. Avatar for VeFold 10. VeFold 1 pt. 47,272
  1. Avatar for Hillbillie 31. Hillbillie Lv 1 9 pts. 47,272
  2. Avatar for roarshock 32. roarshock Lv 1 8 pts. 47,235
  3. Avatar for Trajan464 33. Trajan464 Lv 1 7 pts. 47,209
  4. Avatar for ecali 34. ecali Lv 1 7 pts. 47,189
  5. Avatar for zbp 35. zbp Lv 1 6 pts. 47,189
  6. Avatar for Larini 36. Larini Lv 1 5 pts. 47,169
  7. Avatar for mengzach 37. mengzach Lv 1 5 pts. 47,141
  8. Avatar for Deleted player 38. Deleted player 5 pts. 47,059
  9. Avatar for rosie4loop 39. rosie4loop Lv 1 4 pts. 46,973
  10. Avatar for RichGuilmain 40. RichGuilmain Lv 1 4 pts. 46,963

Comments