Placeholder image of a protein
Icon representing a puzzle

2383: Electron Density Reconstruction 67- extended deadline (Use Trim Tool!)

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
November 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are several chains in this protein, some are the same, some are different from each other. One of them is just a short peptide. Given its large size, the Trim tool may be very much necessary to make progress!

Sequence
DKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGRLTFRKDLFVANVQSFPPAKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRASSDVAVELPFTLMHPKPDDIVFEDFAR VFKKATVYLGKRDFVDHLVEPVDGVVLVTLTCAFRYGRELGLTFRKDLFVAPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPKACGVDYEVKAFKRNSVRLVIRKVQYAPERPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPFEDFAR QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA TNLIELDA

Top groups


  1. Avatar for Go Science 100 pts. 115,508
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 115,113
  3. Avatar for Australia 3. Australia 52 pts. 114,050
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 113,292
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 24 pts. 113,065
  6. Avatar for Contenders 6. Contenders 16 pts. 112,994
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 110,825
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 106,685
  9. Avatar for Ukraine 9. Ukraine 4 pts. 104,715
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 101,356

  1. Avatar for Trajan464 21. Trajan464 Lv 1 36 pts. 110,340
  2. Avatar for akaaka 22. akaaka Lv 1 34 pts. 110,050
  3. Avatar for ProfVince 23. ProfVince Lv 1 32 pts. 109,548
  4. Avatar for BackBuffer 24. BackBuffer Lv 1 30 pts. 108,934
  5. Avatar for drumpeter18yrs9yrs 25. drumpeter18yrs9yrs Lv 1 29 pts. 108,507
  6. Avatar for Idiotboy 26. Idiotboy Lv 1 27 pts. 108,064
  7. Avatar for dcrwheeler 27. dcrwheeler Lv 1 25 pts. 107,839
  8. Avatar for NinjaGreg 28. NinjaGreg Lv 1 24 pts. 107,619
  9. Avatar for jausmh 29. jausmh Lv 1 22 pts. 106,685
  10. Avatar for alcor29 30. alcor29 Lv 1 21 pts. 106,645

Comments


LociOiling Lv 1

The term pucker covers the many spots in this puzzle where there are gaps due to missing residues. This puzzle incorrectly joins up the segments on either side of the gap. Many other puzzles manage to handle the gaps correctly, with the sides of the gap appearing to be in different chains.

This puzzle ended up with lots of straws, where two adjacent segments are over 50 Angstroms apart, when 4 Angstroms is the normal high end. The segments in a straw have terrible ideality. There are also a number of spots that are less dramatic, but still incorrectly bridge a missing residue gap.

For reference, here are the chains as they appeared for me at the end of the puzzle. The small chain D seems to be a true chain, it's separate in Foldit, and its sequence doesn't appear in any other chains.

AA Edit 3.0
Puzzle: 2383: Electron Density Reconstruction 67- extended deadline (Use Trim Tool!)
segment count = 1011
4 chains and ligands
chain A (protein), segments 1-345, length = 345
dkgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafrygrltfrkdlfvanvqsfppakkpltrlqerlikklgehaypftfeippnlpcsvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnlasstllreganreilgiivsykvkvklvvsrassdvavelpftlmhpkpddivfedfar
chain B (protein), segments 346-645, length = 300
vfkkatvylgkrdfvdhlvepvdgvvlvtltcafrygrelgltfrkdlfvapltrlqerlikklgehaypftfeippnlpcsvtlqpgpkacgvdyevkafkrnsvrlvirkvqyaperpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannkrglaldgklkhedtnlasstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpkpfedfar
chain C (protein), segments 646-1003, length = 358
qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisgetifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
chain D (protein), segments 1004-1011, length = 8
tnlielda