Placeholder image of a protein
Icon representing a puzzle

2383: Electron Density Reconstruction 67- extended deadline (Use Trim Tool!)

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
November 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are several chains in this protein, some are the same, some are different from each other. One of them is just a short peptide. Given its large size, the Trim tool may be very much necessary to make progress!

Sequence
DKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGRLTFRKDLFVANVQSFPPAKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRASSDVAVELPFTLMHPKPDDIVFEDFAR VFKKATVYLGKRDFVDHLVEPVDGVVLVTLTCAFRYGRELGLTFRKDLFVAPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPKACGVDYEVKAFKRNSVRLVIRKVQYAPERPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPFEDFAR QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA TNLIELDA

Top groups


  1. Avatar for Go Science 100 pts. 115,508
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 115,113
  3. Avatar for Australia 3. Australia 52 pts. 114,050
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 113,292
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 24 pts. 113,065
  6. Avatar for Contenders 6. Contenders 16 pts. 112,994
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 110,825
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 106,685
  9. Avatar for Ukraine 9. Ukraine 4 pts. 104,715
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 101,356

  1. Avatar for ShadowTactics 41. ShadowTactics Lv 1 10 pts. 97,871
  2. Avatar for fpc 42. fpc Lv 1 9 pts. 96,880
  3. Avatar for Oransche 43. Oransche Lv 1 9 pts. 95,965
  4. Avatar for georg137 44. georg137 Lv 1 8 pts. 95,845
  5. Avatar for RichGuilmain 45. RichGuilmain Lv 1 8 pts. 93,605
  6. Avatar for abiogenesis 46. abiogenesis Lv 1 7 pts. 91,793
  7. Avatar for DScott 47. DScott Lv 1 7 pts. 91,141
  8. Avatar for Donobit 48. Donobit Lv 1 6 pts. 90,023
  9. Avatar for NPrincipi 49. NPrincipi Lv 1 6 pts. 86,915
  10. Avatar for Larini 50. Larini Lv 1 5 pts. 85,966

Comments


LociOiling Lv 1

The term pucker covers the many spots in this puzzle where there are gaps due to missing residues. This puzzle incorrectly joins up the segments on either side of the gap. Many other puzzles manage to handle the gaps correctly, with the sides of the gap appearing to be in different chains.

This puzzle ended up with lots of straws, where two adjacent segments are over 50 Angstroms apart, when 4 Angstroms is the normal high end. The segments in a straw have terrible ideality. There are also a number of spots that are less dramatic, but still incorrectly bridge a missing residue gap.

For reference, here are the chains as they appeared for me at the end of the puzzle. The small chain D seems to be a true chain, it's separate in Foldit, and its sequence doesn't appear in any other chains.

AA Edit 3.0
Puzzle: 2383: Electron Density Reconstruction 67- extended deadline (Use Trim Tool!)
segment count = 1011
4 chains and ligands
chain A (protein), segments 1-345, length = 345
dkgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafrygrltfrkdlfvanvqsfppakkpltrlqerlikklgehaypftfeippnlpcsvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnlasstllreganreilgiivsykvkvklvvsrassdvavelpftlmhpkpddivfedfar
chain B (protein), segments 346-645, length = 300
vfkkatvylgkrdfvdhlvepvdgvvlvtltcafrygrelgltfrkdlfvapltrlqerlikklgehaypftfeippnlpcsvtlqpgpkacgvdyevkafkrnsvrlvirkvqyaperpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannkrglaldgklkhedtnlasstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpkpfedfar
chain C (protein), segments 646-1003, length = 358
qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisgetifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
chain D (protein), segments 1004-1011, length = 8
tnlielda