LociOiling Lv 1
The term pucker covers the many spots in this puzzle where there are gaps due to missing residues. This puzzle incorrectly joins up the segments on either side of the gap. Many other puzzles manage to handle the gaps correctly, with the sides of the gap appearing to be in different chains.
This puzzle ended up with lots of straws, where two adjacent segments are over 50 Angstroms apart, when 4 Angstroms is the normal high end. The segments in a straw have terrible ideality. There are also a number of spots that are less dramatic, but still incorrectly bridge a missing residue gap.
For reference, here are the chains as they appeared for me at the end of the puzzle. The small chain D seems to be a true chain, it's separate in Foldit, and its sequence doesn't appear in any other chains.
AA Edit 3.0 Puzzle: 2383: Electron Density Reconstruction 67- extended deadline (Use Trim Tool!) segment count = 1011 4 chains and ligands chain A (protein), segments 1-345, length = 345 dkgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafrygrltfrkdlfvanvqsfppakkpltrlqerlikklgehaypftfeippnlpcsvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnlasstllreganreilgiivsykvkvklvvsrassdvavelpftlmhpkpddivfedfar chain B (protein), segments 346-645, length = 300 vfkkatvylgkrdfvdhlvepvdgvvlvtltcafrygrelgltfrkdlfvapltrlqerlikklgehaypftfeippnlpcsvtlqpgpkacgvdyevkafkrnsvrlvirkvqyaperpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannkrglaldgklkhedtnlasstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpkpfedfar chain C (protein), segments 646-1003, length = 358 qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisgetifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga chain D (protein), segments 1004-1011, length = 8 tnlielda