Placeholder image of a protein
Icon representing a puzzle

2394: Electron Density Reconstruction 70

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
December 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two of the same protein chain in this one.

Sequence
GSHMGVQHKLDIFLVSEGIAIKEANLLKGDSYGCTIKIKLDKEKTFKFVIVLEPEWIDEIKPIYMKVNDESVELELDYKDATKRIYSAEVVLSSDSVINLFSDVDVSYTSEYPTIKVNTIKKYYSVQNRGMTYVHIESPINTKDKSWFVEKNGWYEDRTHS

Top groups

  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 30,141
  1. Avatar for dcrwheeler
    1. dcrwheeler Lv 1
    100 pts. 35,459
  2. Avatar for LociOiling 2. LociOiling Lv 1 93 pts. 35,444
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 85 pts. 35,273
  4. Avatar for Galaxie 4. Galaxie Lv 1 79 pts. 35,272
  5. Avatar for Punzi Baker 3 5. Punzi Baker 3 Lv 1 72 pts. 35,248
  6. Avatar for gmn 6. gmn Lv 1 66 pts. 35,200
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 61 pts. 35,167
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 55 pts. 35,142
  9. Avatar for grogar7 9. grogar7 Lv 1 51 pts. 35,101
  10. Avatar for ichwilldiesennamen 10. ichwilldiesennamen Lv 1 46 pts. 35,095

Comments