Placeholder image of a protein
Icon representing a puzzle

2394: Electron Density Reconstruction 70

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
December 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two of the same protein chain in this one.

Sequence
GSHMGVQHKLDIFLVSEGIAIKEANLLKGDSYGCTIKIKLDKEKTFKFVIVLEPEWIDEIKPIYMKVNDESVELELDYKDATKRIYSAEVVLSSDSVINLFSDVDVSYTSEYPTIKVNTIKKYYSVQNRGMTYVHIESPINTKDKSWFVEKNGWYEDRTHS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 35,454
  2. Avatar for Go Science 2. Go Science 60 pts. 35,273
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 35,056
  4. Avatar for Contenders 4. Contenders 17 pts. 34,974
  5. Avatar for Marvin's bunch 5. Marvin's bunch 8 pts. 34,860
  6. Avatar for Gargleblasters 6. Gargleblasters 4 pts. 34,444
  7. Avatar for Australia 7. Australia 2 pts. 34,413
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 34,385
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 33,479
  10. Avatar for VeFold 10. VeFold 1 pt. 31,152

  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 15 pts. 34,385
  2. Avatar for akaaka 22. akaaka Lv 1 13 pts. 34,313
  3. Avatar for phi16 23. phi16 Lv 1 12 pts. 34,257
  4. Avatar for silent gene 24. silent gene Lv 1 10 pts. 34,246
  5. Avatar for georg137 25. georg137 Lv 1 9 pts. 34,120
  6. Avatar for alcor29 26. alcor29 Lv 1 8 pts. 33,936
  7. Avatar for guineapig 27. guineapig Lv 1 7 pts. 33,840
  8. Avatar for NPrincipi 28. NPrincipi Lv 1 6 pts. 33,788
  9. Avatar for rosie4loop 29. rosie4loop Lv 1 5 pts. 33,778
  10. Avatar for equilibria 30. equilibria Lv 1 5 pts. 33,730

Comments