Placeholder image of a protein
Icon representing a puzzle

2394: Electron Density Reconstruction 70

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
December 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two of the same protein chain in this one.

Sequence
GSHMGVQHKLDIFLVSEGIAIKEANLLKGDSYGCTIKIKLDKEKTFKFVIVLEPEWIDEIKPIYMKVNDESVELELDYKDATKRIYSAEVVLSSDSVINLFSDVDVSYTSEYPTIKVNTIKKYYSVQNRGMTYVHIESPINTKDKSWFVEKNGWYEDRTHS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 35,454
  2. Avatar for Go Science 2. Go Science 60 pts. 35,273
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 35,056
  4. Avatar for Contenders 4. Contenders 17 pts. 34,974
  5. Avatar for Marvin's bunch 5. Marvin's bunch 8 pts. 34,860
  6. Avatar for Gargleblasters 6. Gargleblasters 4 pts. 34,444
  7. Avatar for Australia 7. Australia 2 pts. 34,413
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 34,385
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 33,479
  10. Avatar for VeFold 10. VeFold 1 pt. 31,152

  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 1 pt. 31,152
  2. Avatar for davi_fold 52. davi_fold Lv 1 1 pt. 31,051
  3. Avatar for loony_toonie 53. loony_toonie Lv 1 1 pt. 30,997
  4. Avatar for rinze 54. rinze Lv 1 1 pt. 30,964
  5. Avatar for furi0us 55. furi0us Lv 1 1 pt. 30,828
  6. Avatar for osc 56. osc Lv 1 1 pt. 30,719
  7. Avatar for abiogenesis 57. abiogenesis Lv 1 1 pt. 30,375
  8. Avatar for HelpME 58. HelpME Lv 1 1 pt. 30,141
  9. Avatar for pruneau_44 59. pruneau_44 Lv 1 1 pt. 29,628
  10. Avatar for kitsoune 60. kitsoune Lv 1 1 pt. 29,296

Comments