Placeholder image of a protein
Icon representing a puzzle

2394: Electron Density Reconstruction 70

Closed since over 2 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
December 18, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two of the same protein chain in this one.

Sequence
GSHMGVQHKLDIFLVSEGIAIKEANLLKGDSYGCTIKIKLDKEKTFKFVIVLEPEWIDEIKPIYMKVNDESVELELDYKDATKRIYSAEVVLSSDSVINLFSDVDVSYTSEYPTIKVNTIKKYYSVQNRGMTYVHIESPINTKDKSWFVEKNGWYEDRTHS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 35,454
  2. Avatar for Go Science 2. Go Science 60 pts. 35,273
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 35,056
  4. Avatar for Contenders 4. Contenders 17 pts. 34,974
  5. Avatar for Marvin's bunch 5. Marvin's bunch 8 pts. 34,860
  6. Avatar for Gargleblasters 6. Gargleblasters 4 pts. 34,444
  7. Avatar for Australia 7. Australia 2 pts. 34,413
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 34,385
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 33,479
  10. Avatar for VeFold 10. VeFold 1 pt. 31,152

  1. Avatar for Altercomp 61. Altercomp Lv 1 1 pt. 28,200
  2. Avatar for puxatudo 63. puxatudo Lv 1 1 pt. 0

Comments