Placeholder image of a protein
Icon representing a puzzle

2399: Revisiting Puzzle 135: E. coli

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,101
  2. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,817
  3. Avatar for METU-BIN 14. METU-BIN 1 pt. 8,697

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,901
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 94 pts. 9,785
  3. Avatar for ichwilldiesennamen 3. ichwilldiesennamen Lv 1 89 pts. 9,784
  4. Avatar for grogar7 4. grogar7 Lv 1 83 pts. 9,736
  5. Avatar for Galaxie 5. Galaxie Lv 1 78 pts. 9,727
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 73 pts. 9,713
  7. Avatar for Sandrix72 7. Sandrix72 Lv 1 68 pts. 9,680
  8. Avatar for guineapig 8. guineapig Lv 1 64 pts. 9,662
  9. Avatar for blazegeek 9. blazegeek Lv 1 60 pts. 9,655
  10. Avatar for Punzi Baker 3 10. Punzi Baker 3 Lv 1 56 pts. 9,630

Comments