Placeholder image of a protein
Icon representing a puzzle

2403: Electron Density Reconstruction 73

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
January 04, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two small, identical chains in this protein, but not all the segments may be visible.

Sequence
GSHMSTLKEVQDNITLHEQRLVTTRQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETKLGELKRELADLIAAQKLASKPVDPTGIEPDDHLKEK

Top groups

  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 26,615
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 21,509
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 28,002
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 93 pts. 27,992
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 86 pts. 27,981
  4. Avatar for Galaxie 4. Galaxie Lv 1 79 pts. 27,977
  5. Avatar for MicElephant 5. MicElephant Lv 1 73 pts. 27,966
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 68 pts. 27,966
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 62 pts. 27,962
  8. Avatar for dcrwheeler 8. dcrwheeler Lv 1 57 pts. 27,959
  9. Avatar for BackBuffer 9. BackBuffer Lv 1 52 pts. 27,952
  10. Avatar for gmn 10. gmn Lv 1 48 pts. 27,944

Comments