Placeholder image of a protein
Icon representing a puzzle

2403: Electron Density Reconstruction 73

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
January 04, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two small, identical chains in this protein, but not all the segments may be visible.

Sequence
GSHMSTLKEVQDNITLHEQRLVTTRQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETKLGELKRELADLIAAQKLASKPVDPTGIEPDDHLKEK

Top groups


  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 26,615
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 21,509

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 28,003
  2. Avatar for Galaxie 2. Galaxie Lv 1 60 pts. 28,000
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 33 pts. 27,992
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 17 pts. 27,986
  5. Avatar for phi16 5. phi16 Lv 1 8 pts. 27,968
  6. Avatar for MicElephant 6. MicElephant Lv 1 4 pts. 27,966
  7. Avatar for alcor29 7. alcor29 Lv 1 2 pts. 27,960
  8. Avatar for jausmh 8. jausmh Lv 1 1 pt. 27,906
  9. Avatar for maithra 9. maithra Lv 1 1 pt. 27,860
  10. Avatar for Bletchley Park 10. Bletchley Park Lv 1 1 pt. 27,849

Comments