Placeholder image of a protein
Icon representing a puzzle

2403: Electron Density Reconstruction 73

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
January 04, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two small, identical chains in this protein, but not all the segments may be visible.

Sequence
GSHMSTLKEVQDNITLHEQRLVTTRQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETKLGELKRELADLIAAQKLASKPVDPTGIEPDDHLKEK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 28,003
  2. Avatar for Go Science 2. Go Science 63 pts. 27,992
  3. Avatar for Contenders 3. Contenders 37 pts. 27,966
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 27,962
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 27,906
  6. Avatar for Australia 6. Australia 5 pts. 27,895
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 27,847
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 27,756
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 27,652
  10. Avatar for VeFold 10. VeFold 1 pt. 27,592

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 28,003
  2. Avatar for Galaxie 2. Galaxie Lv 1 60 pts. 28,000
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 33 pts. 27,992
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 17 pts. 27,986
  5. Avatar for phi16 5. phi16 Lv 1 8 pts. 27,968
  6. Avatar for MicElephant 6. MicElephant Lv 1 4 pts. 27,966
  7. Avatar for alcor29 7. alcor29 Lv 1 2 pts. 27,960
  8. Avatar for jausmh 8. jausmh Lv 1 1 pt. 27,906
  9. Avatar for maithra 9. maithra Lv 1 1 pt. 27,860
  10. Avatar for Bletchley Park 10. Bletchley Park Lv 1 1 pt. 27,849

Comments