Icon representing a puzzle

2405: Revisiting Puzzle 137: Rosetta Decoy

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
January 18, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 11,128
  2. Avatar for Cancer Blasters! 12. Cancer Blasters! 1 pt. 11,060
  3. Avatar for BIOF215 13. BIOF215 1 pt. 10,907
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 10,875
  5. Avatar for METU-BIN 15. METU-BIN 1 pt. 10,141
  6. Avatar for Belgium 16. Belgium 1 pt. 9,257
  7. Avatar for Window Group 17. Window Group 1 pt. 8,438
  1. Avatar for georg137 21. georg137 Lv 1 32 pts. 11,378
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 30 pts. 11,366
  3. Avatar for Deleted player 23. Deleted player 28 pts. 11,326
  4. Avatar for alcor29 24. alcor29 Lv 1 26 pts. 11,319
  5. Avatar for roarshock 25. roarshock Lv 1 25 pts. 11,312
  6. Avatar for g_b 26. g_b Lv 1 23 pts. 11,283
  7. Avatar for Joanna_H 27. Joanna_H Lv 1 22 pts. 11,271
  8. Avatar for fordesk 28. fordesk Lv 1 20 pts. 11,249
  9. Avatar for manu8170 29. manu8170 Lv 1 19 pts. 11,233
  10. Avatar for maithra 30. maithra Lv 1 17 pts. 11,231

Comments

LociOiling Lv 1

The expiration time of the this puzzle keeps on slippin', slippin' into the future. Now it expires at the same time as CACHE puzzle 2407, Friday here in the US.

Not clear why this is happening, but what else is new?