Icon representing a puzzle

2405: Revisiting Puzzle 137: Rosetta Decoy

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
January 18, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 11,128
  2. Avatar for Cancer Blasters! 12. Cancer Blasters! 1 pt. 11,060
  3. Avatar for BIOF215 13. BIOF215 1 pt. 10,907
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 10,875
  5. Avatar for METU-BIN 15. METU-BIN 1 pt. 10,141
  6. Avatar for Belgium 16. Belgium 1 pt. 9,257
  7. Avatar for Window Group 17. Window Group 1 pt. 8,438

  1. Avatar for mengzach 51. mengzach Lv 1 3 pts. 10,834
  2. Avatar for pizpot 52. pizpot Lv 1 3 pts. 10,812
  3. Avatar for haleyg 53. haleyg Lv 1 3 pts. 10,800
  4. Avatar for Serca 54. Serca Lv 1 2 pts. 10,800
  5. Avatar for Hillbillie 55. Hillbillie Lv 1 2 pts. 10,785
  6. Avatar for Kvaksius 56. Kvaksius Lv 1 2 pts. 10,763
  7. Avatar for MeSleepyOne 57. MeSleepyOne Lv 1 2 pts. 10,566
  8. Avatar for Arne Heessels 58. Arne Heessels Lv 1 2 pts. 10,532
  9. Avatar for DScott 59. DScott Lv 1 2 pts. 10,505
  10. Avatar for Dr.Sillem 60. Dr.Sillem Lv 1 1 pt. 10,403

Comments


LociOiling Lv 1

The expiration time of the this puzzle keeps on slippin', slippin' into the future. Now it expires at the same time as CACHE puzzle 2407, Friday here in the US.

Not clear why this is happening, but what else is new?