Icon representing a puzzle

2405: Revisiting Puzzle 137: Rosetta Decoy

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
January 18, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 11,128
  2. Avatar for Cancer Blasters! 12. Cancer Blasters! 1 pt. 11,060
  3. Avatar for BIOF215 13. BIOF215 1 pt. 10,907
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 10,875
  5. Avatar for METU-BIN 15. METU-BIN 1 pt. 10,141
  6. Avatar for Belgium 16. Belgium 1 pt. 9,257
  7. Avatar for Window Group 17. Window Group 1 pt. 8,438

  1. Avatar for Pibeagles1 61. Pibeagles1 Lv 1 1 pt. 10,369
  2. Avatar for Vinara 62. Vinara Lv 1 1 pt. 10,357
  3. Avatar for Alistair69 63. Alistair69 Lv 1 1 pt. 10,350
  4. Avatar for Merf 64. Merf Lv 1 1 pt. 10,329
  5. Avatar for Mohoernchen 65. Mohoernchen Lv 1 1 pt. 10,316
  6. Avatar for smol_boi_danno 66. smol_boi_danno Lv 1 1 pt. 10,301
  7. Avatar for rinze 67. rinze Lv 1 1 pt. 10,288
  8. Avatar for VU21BTEN0100033 68. VU21BTEN0100033 Lv 1 1 pt. 10,283
  9. Avatar for carxo 69. carxo Lv 1 1 pt. 10,248
  10. Avatar for jtwolff 70. jtwolff Lv 1 1 pt. 10,220

Comments


LociOiling Lv 1

The expiration time of the this puzzle keeps on slippin', slippin' into the future. Now it expires at the same time as CACHE puzzle 2407, Friday here in the US.

Not clear why this is happening, but what else is new?