Icon representing a puzzle

2414: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 9,426
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,692
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 94 pts. 11,620
  3. Avatar for MicElephant 3. MicElephant Lv 1 88 pts. 11,479
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 82 pts. 11,468
  5. Avatar for Galaxie 5. Galaxie Lv 1 77 pts. 11,428
  6. Avatar for grogar7 6. grogar7 Lv 1 72 pts. 11,413
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 67 pts. 11,394
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 63 pts. 11,386
  9. Avatar for BackBuffer 9. BackBuffer Lv 1 58 pts. 11,381
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 54 pts. 11,379

Comments