Icon representing a puzzle

2414: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,700
  2. Avatar for Go Science 2. Go Science 60 pts. 11,620
  3. Avatar for Contenders 3. Contenders 33 pts. 11,479
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 11,364
  5. Avatar for Australia 5. Australia 8 pts. 11,259
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 11,190
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 11,114
  8. Avatar for VeFold 8. VeFold 1 pt. 11,071
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,942
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 10,840

  1. Avatar for alcor29 31. alcor29 Lv 1 9 pts. 11,061
  2. Avatar for heather-1 32. heather-1 Lv 1 8 pts. 11,030
  3. Avatar for rosie4loop 33. rosie4loop Lv 1 7 pts. 11,029
  4. Avatar for Hillbillie 34. Hillbillie Lv 1 7 pts. 11,027
  5. Avatar for hansvandenhof 35. hansvandenhof Lv 1 6 pts. 11,014
  6. Avatar for Larini 36. Larini Lv 1 5 pts. 11,000
  7. Avatar for ShadowTactics 37. ShadowTactics Lv 1 5 pts. 10,942
  8. Avatar for anthonyamartin77 38. anthonyamartin77 Lv 1 4 pts. 10,932
  9. Avatar for kitsoune 39. kitsoune Lv 1 4 pts. 10,911
  10. Avatar for Oransche 40. Oransche Lv 1 3 pts. 10,887

Comments