Icon representing a puzzle

2420: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 11,280
  2. Avatar for Penn State Biomolecular Engineers 12. Penn State Biomolecular Engineers 1 pt. 11,083
  3. Avatar for Russian team 13. Russian team 1 pt. 11,072
  4. Avatar for That's a Wrap! 14. That's a Wrap! 1 pt. 10,997
  5. Avatar for OmHS 15. OmHS 1 pt. 10,873
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 10,507
  1. Avatar for DiscoveryPlaceScience 91. DiscoveryPlaceScience Lv 1 1 pt. 9,464
  2. Avatar for TeddyPopsicle23 92. TeddyPopsicle23 Lv 1 1 pt. 9,348
  3. Avatar for phi16 93. phi16 Lv 1 1 pt. 9,348
  4. Avatar for malloyk 94. malloyk Lv 1 1 pt. 9,348
  5. Avatar for yang1234 95. yang1234 Lv 1 1 pt. 9,348
  6. Avatar for AngeloGiannakoulis 96. AngeloGiannakoulis Lv 1 1 pt. 9,348
  7. Avatar for Kyle123 97. Kyle123 Lv 1 1 pt. 9,348
  8. Avatar for Minton13 98. Minton13 Lv 1 1 pt. 9,348
  9. Avatar for finleym 99. finleym Lv 1 1 pt. 9,348

Comments