Icon representing a puzzle

2420: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 2 years ago

Novice Overall Prediction

Summary

Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 11,280
  2. Avatar for Penn State Biomolecular Engineers 12. Penn State Biomolecular Engineers 1 pt. 11,083
  3. Avatar for Russian team 13. Russian team 1 pt. 11,072
  4. Avatar for That's a Wrap! 14. That's a Wrap! 1 pt. 10,997
  5. Avatar for OmHS 15. OmHS 1 pt. 10,873
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 10,507
  1. Avatar for WBarme1234 31. WBarme1234 Lv 1 17 pts. 11,658
  2. Avatar for maithra 32. maithra Lv 1 15 pts. 11,591
  3. Avatar for rosie4loop 33. rosie4loop Lv 1 14 pts. 11,588
  4. Avatar for jausmh 34. jausmh Lv 1 13 pts. 11,583
  5. Avatar for roarshock 35. roarshock Lv 1 12 pts. 11,578
  6. Avatar for heather-1 36. heather-1 Lv 1 11 pts. 11,564
  7. Avatar for Antibrad 37. Antibrad Lv 1 11 pts. 11,497
  8. Avatar for shapethink 38. shapethink Lv 1 10 pts. 11,496
  9. Avatar for Oransche 39. Oransche Lv 1 9 pts. 11,476
  10. Avatar for ProfVince 40. ProfVince Lv 1 8 pts. 11,449

Comments