Icon representing a puzzle

2420: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 11,280
  2. Avatar for Russian team 13. Russian team 1 pt. 11,072
  3. Avatar for That's a Wrap! 14. That's a Wrap! 1 pt. 10,997
  4. Avatar for OmHS 15. OmHS 1 pt. 10,873

  1. Avatar for Trajan464 51. Trajan464 Lv 1 3 pts. 11,147
  2. Avatar for haleyg 52. haleyg Lv 1 3 pts. 11,139
  3. Avatar for Dr.Sillem 53. Dr.Sillem Lv 1 3 pts. 11,084
  4. Avatar for I<3Money 54. I<3Money Lv 1 3 pts. 11,083
  5. Avatar for ComputerMage 55. ComputerMage Lv 1 2 pts. 11,072
  6. Avatar for AHart313 56. AHart313 Lv 1 2 pts. 10,997
  7. Avatar for jamiexq 57. jamiexq Lv 1 2 pts. 10,928
  8. Avatar for Mohoernchen 58. Mohoernchen Lv 1 2 pts. 10,907
  9. Avatar for BlueEqualsRed 59. BlueEqualsRed Lv 1 2 pts. 10,887
  10. Avatar for carxo 60. carxo Lv 1 1 pt. 10,876

Comments