Placeholder image of a protein
Icon representing a puzzle

2418: Electron Density Reconstruction 78

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 09, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's a monomer, but not every segment may be visible.

Sequence
MAGSSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRIGT

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 22,487
  2. Avatar for OmHS 12. OmHS 1 pt. 22,020
  3. Avatar for That's a Wrap! 13. That's a Wrap! 1 pt. 21,860
  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 22,890
  2. Avatar for LociOiling 2. LociOiling Lv 1 93 pts. 22,884
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 86 pts. 22,882
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 80 pts. 22,871
  5. Avatar for gmn 5. gmn Lv 1 74 pts. 22,858
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 68 pts. 22,854
  7. Avatar for Punzi Baker 3 7. Punzi Baker 3 Lv 1 63 pts. 22,852
  8. Avatar for grogar7 8. grogar7 Lv 1 58 pts. 22,850
  9. Avatar for alcor29 9. alcor29 Lv 1 53 pts. 22,848
  10. Avatar for BackBuffer 10. BackBuffer Lv 1 49 pts. 22,846

Comments