Placeholder image of a protein
Icon representing a puzzle

2421: Electron Density Reconstruction 79

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 16, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has both a monomer protein and also a bit of DNA as well, so some recipes might struggle with the DNA portion.

Sequence
EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPFPSN TATCGATA

Top groups


  1. Avatar for Beta Folders 11. Beta Folders 2 pts. 9,490
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,110
  3. Avatar for OmHS 13. OmHS 1 pt. 8,869
  4. Avatar for That's a Wrap! 16. That's a Wrap! 1 pt. 6,308
  5. Avatar for GUGITBIOTECH 17. GUGITBIOTECH 1 pt. 0
  6. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 0

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 18,710
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 94 pts. 18,572
  3. Avatar for grogar7 3. grogar7 Lv 1 89 pts. 18,530
  4. Avatar for Punzi Baker 3 4. Punzi Baker 3 Lv 1 83 pts. 18,464
  5. Avatar for Steven Pletsch 5. Steven Pletsch Lv 1 78 pts. 18,447
  6. Avatar for gmn 6. gmn Lv 1 73 pts. 18,405
  7. Avatar for Sandrix72 7. Sandrix72 Lv 1 69 pts. 18,388
  8. Avatar for AlkiP0Ps 8. AlkiP0Ps Lv 1 64 pts. 18,336
  9. Avatar for LociOiling 9. LociOiling Lv 1 60 pts. 18,290
  10. Avatar for WBarme1234 10. WBarme1234 Lv 1 56 pts. 18,130

Comments