Icon representing a puzzle

2429: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.

Sequence
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,661
  2. Avatar for Contenders 2. Contenders 71 pts. 11,449
  3. Avatar for Go Science 3. Go Science 49 pts. 11,442
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 11,413
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 11,361
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 11,300
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 8 pts. 11,297
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 11,167
  9. Avatar for Australia 9. Australia 3 pts. 11,097
  10. Avatar for VeFold 10. VeFold 2 pts. 11,079

  1. Avatar for zo3xiaJonWeinberg 51. zo3xiaJonWeinberg Lv 1 1 pt. 10,817
  2. Avatar for Trajan464 52. Trajan464 Lv 1 1 pt. 10,773
  3. Avatar for mengzach 53. mengzach Lv 1 1 pt. 10,766
  4. Avatar for Arne Heessels 54. Arne Heessels Lv 1 1 pt. 10,691
  5. Avatar for Tehnologik1 55. Tehnologik1 Lv 1 1 pt. 10,651
  6. Avatar for TheGUmmer 56. TheGUmmer Lv 1 1 pt. 10,485
  7. Avatar for Mohoernchen 57. Mohoernchen Lv 1 1 pt. 10,459
  8. Avatar for Merf 58. Merf Lv 1 1 pt. 10,455
  9. Avatar for Arlind1 59. Arlind1 Lv 1 1 pt. 10,447
  10. Avatar for DScott 60. DScott Lv 1 1 pt. 10,417

Comments