Icon representing a puzzle

2429: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.

Sequence
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,661
  2. Avatar for Contenders 2. Contenders 71 pts. 11,449
  3. Avatar for Go Science 3. Go Science 49 pts. 11,442
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 11,413
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 11,361
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 11,300
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 8 pts. 11,297
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 11,167
  9. Avatar for Australia 9. Australia 3 pts. 11,097
  10. Avatar for VeFold 10. VeFold 2 pts. 11,079

  1. Avatar for evifnoskcaj 61. evifnoskcaj Lv 1 1 pt. 10,415
  2. Avatar for carxo 62. carxo Lv 1 1 pt. 10,405
  3. Avatar for rinze 63. rinze Lv 1 1 pt. 10,380
  4. Avatar for defnotarobot 64. defnotarobot Lv 1 1 pt. 10,326
  5. Avatar for B. A. Beder 65. B. A. Beder Lv 1 1 pt. 10,325
  6. Avatar for froschi2 66. froschi2 Lv 1 1 pt. 10,312
  7. Avatar for pruneau_44 67. pruneau_44 Lv 1 1 pt. 10,305
  8. Avatar for Nehal_Revuri 68. Nehal_Revuri Lv 1 1 pt. 10,267
  9. Avatar for Sally_Dogo 69. Sally_Dogo Lv 1 1 pt. 10,228
  10. Avatar for folder20 70. folder20 Lv 1 1 pt. 10,204

Comments