Icon representing a puzzle

2429: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.

Sequence
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,661
  2. Avatar for Contenders 2. Contenders 71 pts. 11,449
  3. Avatar for Go Science 3. Go Science 49 pts. 11,442
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 11,413
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 11,361
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 11,300
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 8 pts. 11,297
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 11,167
  9. Avatar for Australia 9. Australia 3 pts. 11,097
  10. Avatar for VeFold 10. VeFold 2 pts. 11,079

  1. Avatar for man_the_stan 71. man_the_stan Lv 1 1 pt. 10,166
  2. Avatar for 5lboy0609 72. 5lboy0609 Lv 1 1 pt. 10,029
  3. Avatar for Tolu455 73. Tolu455 Lv 1 1 pt. 10,008
  4. Avatar for serengw 74. serengw Lv 1 1 pt. 9,696
  5. Avatar for uwase25 75. uwase25 Lv 1 1 pt. 9,118
  6. Avatar for agcohn821 76. agcohn821 Lv 1 1 pt. 9,090

Comments