Icon representing a puzzle

2444: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since almost 2 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,028
  2. Avatar for Go Science 2. Go Science 56 pts. 11,915
  3. Avatar for Contenders 3. Contenders 29 pts. 11,715
  4. Avatar for Marvin's bunch 4. Marvin's bunch 14 pts. 11,303
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 6 pts. 11,259
  6. Avatar for Australia 6. Australia 2 pts. 11,249
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 1 pt. 11,129
  8. Avatar for BOINC@Poland 8. BOINC@Poland 1 pt. 11,089
  9. Avatar for VeFold 9. VeFold 1 pt. 10,797
  10. Avatar for G10 Life Science 10. G10 Life Science 1 pt. 8,139

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,023
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 94 pts. 11,915
  3. Avatar for MicElephant 3. MicElephant Lv 1 88 pts. 11,715
  4. Avatar for Serca 4. Serca Lv 1 82 pts. 11,680
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 77 pts. 11,627
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 72 pts. 11,614
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 67 pts. 11,518
  8. Avatar for Marvelz 8. Marvelz Lv 1 62 pts. 11,487
  9. Avatar for grogar7 9. grogar7 Lv 1 58 pts. 11,485
  10. Avatar for akaaka 10. akaaka Lv 1 54 pts. 11,462

Comments