Icon representing a puzzle

2447: Revisiting Puzzle 165: Rosetta Model 15

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,492
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,427
  3. Avatar for BIOF215 13. BIOF215 1 pt. 10,203
  4. Avatar for Creating Heroes 2.0 14. Creating Heroes 2.0 1 pt. 9,639
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,010
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 94 pts. 11,883
  3. Avatar for Serca 3. Serca Lv 1 89 pts. 11,848
  4. Avatar for blazegeek 4. blazegeek Lv 1 83 pts. 11,729
  5. Avatar for grogar7 5. grogar7 Lv 1 78 pts. 11,499
  6. Avatar for drjr 6. drjr Lv 1 73 pts. 11,484
  7. Avatar for Galaxie 7. Galaxie Lv 1 69 pts. 11,476
  8. Avatar for Steven Pletsch 8. Steven Pletsch Lv 1 64 pts. 11,441
  9. Avatar for Marvelz 9. Marvelz Lv 1 60 pts. 11,404
  10. Avatar for guineapig 10. guineapig Lv 1 56 pts. 11,381

Comments