Icon representing a puzzle

2447: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,027
  2. Avatar for Go Science 2. Go Science 68 pts. 11,883
  3. Avatar for Contenders 3. Contenders 44 pts. 11,381
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 11,182
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,153
  7. Avatar for VeFold 7. VeFold 5 pts. 10,958
  8. Avatar for Australia 8. Australia 3 pts. 10,900
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,845
  10. Avatar for Russian team 10. Russian team 1 pt. 10,714

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 12,027
  2. Avatar for LociOiling 2. LociOiling Lv 1 47 pts. 12,011
  3. Avatar for gmn 3. gmn Lv 1 19 pts. 11,979
  4. Avatar for drjr 4. drjr Lv 1 7 pts. 11,978
  5. Avatar for alcor29 5. alcor29 Lv 1 2 pts. 11,968
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 1 pt. 11,735
  7. Avatar for Sandrix72 7. Sandrix72 Lv 1 1 pt. 11,708
  8. Avatar for silent gene 8. silent gene Lv 1 1 pt. 11,698

Comments