Placeholder image of a protein
Icon representing a puzzle

2436: Electron Density Reconstruction 84

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
March 25, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a useful note from Bletchley Park for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*AP*GP*A)-3'

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 52,393
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 52,065
  3. Avatar for WSU Bioc Spring 2016 13. WSU Bioc Spring 2016 1 pt. 35,212

  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 47 pts. 54,672
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 43 pts. 54,489
  3. Avatar for Punzi Baker 3 13. Punzi Baker 3 Lv 1 40 pts. 54,475
  4. Avatar for drjr 14. drjr Lv 1 36 pts. 54,381
  5. Avatar for NinjaGreg 15. NinjaGreg Lv 1 33 pts. 54,322
  6. Avatar for alcor29 16. alcor29 Lv 1 30 pts. 54,223
  7. Avatar for fpc 17. fpc Lv 1 28 pts. 54,181
  8. Avatar for guineapig 18. guineapig Lv 1 25 pts. 54,082
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 23 pts. 53,865
  10. Avatar for akaaka 20. akaaka Lv 1 21 pts. 53,762

Comments