Placeholder image of a protein
Icon representing a puzzle

2436: Electron Density Reconstruction 84

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
March 25, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a useful note from Bletchley Park for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*AP*GP*A)-3'

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 52,393
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 52,065
  3. Avatar for WSU Bioc Spring 2016 13. WSU Bioc Spring 2016 1 pt. 35,212

  1. Avatar for MicElephant 21. MicElephant Lv 1 19 pts. 53,718
  2. Avatar for georg137 22. georg137 Lv 1 17 pts. 53,620
  3. Avatar for Ikuso 23. Ikuso Lv 1 16 pts. 53,587
  4. Avatar for BootsMcGraw 24. BootsMcGraw Lv 1 14 pts. 53,475
  5. Avatar for roarshock 25. roarshock Lv 1 13 pts. 53,416
  6. Avatar for man_the_stan 26. man_the_stan Lv 1 11 pts. 53,361
  7. Avatar for manu8170 27. manu8170 Lv 1 10 pts. 53,327
  8. Avatar for WBarme1234 28. WBarme1234 Lv 1 9 pts. 53,010
  9. Avatar for ProfVince 29. ProfVince Lv 1 8 pts. 52,941
  10. Avatar for ucad 30. ucad Lv 1 7 pts. 52,765

Comments