Placeholder image of a protein
Icon representing a puzzle

2436: Electron Density Reconstruction 84

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
March 25, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a useful note from Bletchley Park for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*AP*GP*A)-3'

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 52,393
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 52,065
  3. Avatar for WSU Bioc Spring 2016 13. WSU Bioc Spring 2016 1 pt. 35,212

  1. Avatar for orily1337 41. orily1337 Lv 1 2 pts. 51,839
  2. Avatar for VU21BTEN0100050 42. VU21BTEN0100050 Lv 1 2 pts. 51,761
  3. Avatar for mengzach 43. mengzach Lv 1 2 pts. 51,360
  4. Avatar for Dr.Sillem 44. Dr.Sillem Lv 1 1 pt. 51,313
  5. Avatar for pfirth 45. pfirth Lv 1 1 pt. 51,103
  6. Avatar for jtobrien 46. jtobrien Lv 1 1 pt. 51,061
  7. Avatar for Serca 47. Serca Lv 1 1 pt. 51,006
  8. Avatar for maithra 48. maithra Lv 1 1 pt. 50,683
  9. Avatar for Arne Heessels 49. Arne Heessels Lv 1 1 pt. 50,590
  10. Avatar for Merf 50. Merf Lv 1 1 pt. 50,543

Comments