Placeholder image of a protein
Icon representing a puzzle

2436: Electron Density Reconstruction 84

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
March 25, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a useful note from Bletchley Park for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*AP*GP*A)-3'

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 52,393
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 52,065
  3. Avatar for WSU Bioc Spring 2016 13. WSU Bioc Spring 2016 1 pt. 35,212

  1. Avatar for JackONeill12 51. JackONeill12 Lv 1 1 pt. 50,532
  2. Avatar for phi16 52. phi16 Lv 1 1 pt. 50,523
  3. Avatar for Vinara 53. Vinara Lv 1 1 pt. 50,425
  4. Avatar for Alistair69 54. Alistair69 Lv 1 1 pt. 50,423
  5. Avatar for abiogenesis 55. abiogenesis Lv 1 1 pt. 50,402
  6. Avatar for pruneau_44 56. pruneau_44 Lv 1 1 pt. 50,359
  7. Avatar for Mohoernchen 57. Mohoernchen Lv 1 1 pt. 50,206
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 50,137
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 50,095
  10. Avatar for carxo 60. carxo Lv 1 1 pt. 49,989

Comments