Placeholder image of a protein
Icon representing a puzzle

2436: Electron Density Reconstruction 84

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
March 25, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a useful note from Bletchley Park for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*AP*GP*A)-3'

Top groups


  1. Avatar for Go Science 100 pts. 55,982
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 55,896
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 55,482
  4. Avatar for Contenders 4. Contenders 24 pts. 54,489
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 54,181
  6. Avatar for Australia 6. Australia 7 pts. 53,865
  7. Avatar for Kotocycle 7. Kotocycle 4 pts. 53,587
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 53,010
  9. Avatar for VeFold 9. VeFold 1 pt. 52,625
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 52,591

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 55,892
  2. Avatar for Galaxie 2. Galaxie Lv 1 41 pts. 55,888
  3. Avatar for alcor29 3. alcor29 Lv 1 14 pts. 55,797
  4. Avatar for silent gene 4. silent gene Lv 1 4 pts. 55,689
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 1 pt. 55,528
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 1 pt. 55,158
  7. Avatar for Sandrix72 7. Sandrix72 Lv 1 1 pt. 54,179

Comments