Placeholder image of a protein
Icon representing a puzzle

2442: Electron Density Reconstruction 86 (use trim)

Closed since about 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
April 09, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This is a big structure with several chains, so the trim tool is highly recommended.

Sequence
GGLGGYMLGSAMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQNTFVHDCVNITVKQHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESE QVQLQQSGTELVMPGASVKMSCKASGYTFTDYWMHWVKQRPGQGLEWIGSIDPSDSYTSHNEKFKGKATLTVDESSSTAYMQLSSLTSEDSAVYFCSRSGYGYYAMEYWGQGTSVTVSSAKTTPPSVYPLAPGGGATNSMVTLGCLVKGYFPEPVTVTWNSGSLSGGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR DIVLTQSPAILSVSPGERVSFSCRASQNIGTSIHWYQQRTNESPRLIIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQSNTWPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSETDQDSKDSTYSMSSTLTLTKDEYERHNTYTCEATHKTSTSPIVKSFNRNE

Top groups


  1. Avatar for Marvin's bunch 100 pts. 50,635
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 50,429
  3. Avatar for Go Science 3. Go Science 41 pts. 50,354
  4. Avatar for Australia 4. Australia 24 pts. 48,665
  5. Avatar for Contenders 5. Contenders 14 pts. 48,518
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 48,463
  7. Avatar for Kotocycle 7. Kotocycle 4 pts. 46,590
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 46,289
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 46,283
  10. Avatar for VeFold 10. VeFold 1 pt. 45,547

  1. Avatar for Swapper242 51. Swapper242 Lv 1 1 pt. 38,622
  2. Avatar for man_the_stan 52. man_the_stan Lv 1 1 pt. 38,446
  3. Avatar for JackONeill12 53. JackONeill12 Lv 1 1 pt. 38,026
  4. Avatar for Arne Heessels 54. Arne Heessels Lv 1 1 pt. 35,662
  5. Avatar for Deleted player 55. Deleted player 1 pt. 34,716
  6. Avatar for Autumobile 56. Autumobile Lv 1 1 pt. 34,579
  7. Avatar for abiogenesis 57. abiogenesis Lv 1 1 pt. 33,753
  8. Avatar for ShadowTactics 58. ShadowTactics Lv 1 1 pt. 28,615
  9. Avatar for Vinara 59. Vinara Lv 1 1 pt. 18,102
  10. Avatar for stimpy81 60. stimpy81 Lv 1 1 pt. 0

Comments