Placeholder image of a protein
Icon representing a puzzle

2448: Electron Density Reconstruction 88

Closed since almost 2 years ago

Novice Overall Electron Density

Summary

Created
April 18, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This is part 2 of the Watson-Crick vs Hoogsteen question posed in Reconstruction Puzzle 84, now starting with a Watson-Crick base pair. Also, a reminder of the useful note from Bletchley Park for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*AP*GP*A)-3'

Top groups

  1. Avatar for 2903_2024 11. 2903_2024 1 pt. 49,614
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 35,774
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 24,284
  1. Avatar for Galaxie 11. Galaxie Lv 1 45 pts. 54,267
  2. Avatar for MicElephant 12. MicElephant Lv 1 41 pts. 54,242
  3. Avatar for Punzi Baker 3 13. Punzi Baker 3 Lv 1 38 pts. 54,184
  4. Avatar for latin krepin 14. latin krepin Lv 1 35 pts. 54,080
  5. Avatar for drjr 15. drjr Lv 1 31 pts. 53,916
  6. Avatar for vs 16. vs Lv 1 29 pts. 53,821
  7. Avatar for grogar7 17. grogar7 Lv 1 26 pts. 53,804
  8. Avatar for guineapig 18. guineapig Lv 1 24 pts. 53,781
  9. Avatar for fpc 19. fpc Lv 1 21 pts. 53,606
  10. Avatar for toshiue 20. toshiue Lv 1 19 pts. 53,479

Comments

grogar7 Lv 1

Frequent errors running trim operation on this puzzle. No DNA segments in selection